Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.50: dsRBD-like [54767] (5 superfamilies) alpha-beta(3)-alpha; 2 layers: alpha/beta |
Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families) |
Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein) |
Protein Ribosomal S5 protein, N-terminal domain [54779] (3 species) lacks the N-terminal helix |
Species Thermus thermophilus [TaxId:274] [54781] (36 PDB entries) Uniprot P27152 |
Domain d1i94e2: 1i94 E:2-73 [61996] Other proteins in same PDB: d1i94b_, d1i94c1, d1i94c2, d1i94d_, d1i94e1, d1i94f_, d1i94g_, d1i94h_, d1i94i_, d1i94j_, d1i94k_, d1i94l_, d1i94m_, d1i94n_, d1i94o_, d1i94p_, d1i94q_, d1i94r_, d1i94s_, d1i94t_, d1i94u_ complexed with mg, wo2, zn |
PDB Entry: 1i94 (more details), 3.2 Å
SCOP Domain Sequences for d1i94e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i94e2 d.50.1.2 (E:2-73) Ribosomal S5 protein, N-terminal domain {Thermus thermophilus [TaxId: 274]} petdfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyy arrnmvevplqn
Timeline for d1i94e2: