SCOPe 2.06: Domain d1i94c2: 1i94 C:107-207

Lineage for d1i94c2 (1i94 C:107-207)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
   alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143

4. Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family)
   automatically mapped to Pfam PF00189

5. Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)

6. Protein Ribosomal protein S3 C-terminal domain [54823] (2 species)

7. Species Thermus thermophilus [TaxId:274] [54824] (36 PDB entries)
   Uniprot P80372

8. Domain d1i94c2: 1i94 C:107-207 [61993]
   Other proteins in same PDB: d1i94b_, d1i94c1, d1i94d_, d1i94e1, d1i94e2, d1i94f_, d1i94g_, d1i94h_, d1i94i_, d1i94j_, d1i94k_, d1i94l_, d1i94m_, d1i94n_, d1i94o_, d1i94p_, d1i94q_, d1i94r_, d1i94s_, d1i94t_, d1i94u_
   complexed with mg, wo2, zn

Details for d1i94c2

PDB Entry: 1i94, 3.2 Å

PDB Description: crystal structures of the small ribosomal subunit with tetracycline, edeine and if3

PDB Compounds: (C:) 30S ribosomal protein S3

SCOPe Domain Sequences for d1i94c2:

Sequence; same for both SEQRES and ATOM records:

>d1i94c2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus [TaxId: 274]}
qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte
waaqgrvplhtlranidygfalarttygvlgvkayiflgev

Timeline for d1i94c2:

• d1i94c2 first appeared in SCOP 1.57
  
• d1i94c2 appears in SCOPe 2.05
  
• d1i94c2 appears in SCOPe 2.07
  
• d1i94c2 appears in the current release, SCOPe 2.08