Lineage for d1i94c1 (1i94 C:2-106)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 722707Fold d.52: Alpha-lytic protease prodomain-like [54805] (8 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 722734Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 722735Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins)
  6. 722748Protein Ribosomal protein S3 N-terminal domain [54816] (2 species)
  7. 722751Species Thermus thermophilus [TaxId:274] [54817] (36 PDB entries)
  8. 722760Domain d1i94c1: 1i94 C:2-106 [61992]
    Other proteins in same PDB: d1i94b_, d1i94c2, d1i94d_, d1i94e1, d1i94e2, d1i94f_, d1i94g_, d1i94h_, d1i94i_, d1i94j_, d1i94k_, d1i94l_, d1i94m_, d1i94n_, d1i94o_, d1i94p_, d1i94q_, d1i94r_, d1i94s_, d1i94t_, d1i94u_
    complexed with mg, wo2, zn

Details for d1i94c1

PDB Entry: 1i94 (more details), 3.2 Å

PDB Description: crystal structures of the small ribosomal subunit with tetracycline, edeine and if3
PDB Compounds: (C:) 30S ribosomal protein S3

SCOP Domain Sequences for d1i94c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i94c1 d.52.3.1 (C:2-106) Ribosomal protein S3 N-terminal domain {Thermus thermophilus [TaxId: 274]}
gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqev

SCOP Domain Coordinates for d1i94c1:

Click to download the PDB-style file with coordinates for d1i94c1.
(The format of our PDB-style files is described here.)

Timeline for d1i94c1: