SCOP 1.75: Domain d1i8pd_: 1i8p D:

Lineage for d1i8pd_ (1i8p D:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (8 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)

6. Protein Cytochrome c2 [46650] (8 species)

7. Species Rhodopseudomonas palustris [TaxId:1076] [46655] (4 PDB entries)

8. Domain d1i8pd_: 1i8p D: [61983]
   complexed with hec

Details for d1i8pd_

PDB Entry: 1i8p, 1.95 Å

PDB Description: structure determination of the ferrocytochrome c2 from rhodopseudomonas palustris

PDB Compounds: (D:) cytochrome c2

SCOP Domain Sequences for d1i8pd_:

Sequence; same for both SEQRES and ATOM records:

>d1i8pd_ a.3.1.1 (D:) Cytochrome c2 {Rhodopseudomonas palustris [TaxId: 1076]}
edakageavfkqcmtchradknmvgpalagvvgrkagtaagftysplnhnsgeaglvwta
dnivpyladpnaflkkfltekgkadqavgvtkmtfklaneqqrkdvvaylatlk

Timeline for d1i8pd_:

• d1i8pd_ first appeared in SCOP 1.57
  
• d1i8pd_ appears in SCOP 1.73
  
• d1i8pd_ appears in SCOPe 2.01
  
• d1i8pd_ appears in the current release, SCOPe 2.08