Class a: All alpha proteins [46456] (171 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (8 families) covalently-bound heme completes the core |
Family a.3.1.1: monodomain cytochrome c [46627] (14 proteins) |
Protein Cytochrome c2 [46650] (8 species) |
Species Rhodopseudomonas palustris [TaxId:1076] [46655] (4 PDB entries) |
Domain d1i8pb_: 1i8p B: [61981] |
PDB Entry: 1i8p (more details), 1.95 Å
SCOP Domain Sequences for d1i8pb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i8pb_ a.3.1.1 (B:) Cytochrome c2 {Rhodopseudomonas palustris} edakageavfkqcmtchradknmvgpalagvvgrkagtaagftysplnhnsgeaglvwta dnivpyladpnaflkkfltekgkadqavgvtkmtfklaneqqrkdvvaylatlk
Timeline for d1i8pb_: