![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein Immunoreceptor CTLA-4 (CD152), N-terminal fragment [48939] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48940] (4 PDB entries) |
![]() | Domain d1i8ld_: 1i8l D: [61975] Other proteins in same PDB: d1i8la1, d1i8la2, d1i8lb1, d1i8lb2 b7-1 co-stimulatory complex complexed with man, nag |
PDB Entry: 1i8l (more details), 3 Å
SCOPe Domain Sequences for d1i8ld_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i8ld_ b.1.1.1 (D:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Human (Homo sapiens) [TaxId: 9606]} mhvaqpavvlassrgiasfvceyaspgkatevrvtvlrqadsqvtevcaatymmgneltf lddsictgtssgnqvnltiqglramdtglyickvelmypppyylgigngaqiyvidpe
Timeline for d1i8ld_: