SCOP 1.69: Domain d1i8ld_: 1i8l D:

Lineage for d1i8ld_ (1i8l D:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)

6. Protein Immunoreceptor CTLA-4 (CD152), N-terminal fragment [48939] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48940] (3 PDB entries)

8. Domain d1i8ld_: 1i8l D: [61975]
   Other proteins in same PDB: d1i8la1, d1i8la2, d1i8lb1, d1i8lb2
   b7-1 co-stimulatory complex

Details for d1i8ld_

PDB Entry: 1i8l, 3 Å

PDB Description: human b7-1/ctla-4 co-stimulatory complex

SCOP Domain Sequences for d1i8ld_:

Sequence; same for both SEQRES and ATOM records:

>d1i8ld_ b.1.1.1 (D:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Human (Homo sapiens)}
mhvaqpavvlassrgiasfvceyaspgkatevrvtvlrqadsqvtevcaatymmgneltf
lddsictgtssgnqvnltiqglramdtglyickvelmypppyylgigngaqiyvidpe

Timeline for d1i8ld_:

• d1i8ld_ first appeared in SCOP 1.57
  
• d1i8ld_ appears in SCOP 1.67
  
• d1i8ld_ appears in SCOP 1.71
  
• d1i8ld_ appears in the current release, SCOPe 2.08