SCOPe 2.07: Domain d1i8lc_: 1i8l C:

Lineage for d1i8lc_ (1i8l C:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoreceptor CTLA-4 (CD152), N-terminal fragment [48939] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48940] (8 PDB entries)

8. Domain d1i8lc_: 1i8l C: [61974]
   Other proteins in same PDB: d1i8la1, d1i8la2, d1i8lb1, d1i8lb2
   b7-1 co-stimulatory complex
   complexed with man, nag

Details for d1i8lc_

PDB Entry: 1i8l, 3 Å

PDB Description: human b7-1/ctla-4 co-stimulatory complex

PDB Compounds: (C:) cytotoxic t-lymphocyte protein 4

SCOPe Domain Sequences for d1i8lc_:

Sequence; same for both SEQRES and ATOM records:

>d1i8lc_ b.1.1.1 (C:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Human (Homo sapiens) [TaxId: 9606]}
mhvaqpavvlassrgiasfvceyaspgkatevrvtvlrqadsqvtevcaatymmgneltf
lddsictgtssgnqvnltiqglramdtglyickvelmypppyylgigngaqiyvidpe

Timeline for d1i8lc_:

• d1i8lc_ first appeared in SCOP 1.57
  
• d1i8lc_ appears in SCOPe 2.06
  
• d1i8lc_ appears in the current release, SCOPe 2.08