SCOPe 2.08: Domain d1i8lb2: 1i8l B:106-199

Lineage for d1i8lb2 (1i8l B:106-199)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.3: C2 set domains [49142] (8 proteins)

6. Protein CD80, second domain [49157] (1 species)
   a soluble form of b7-1

7. Species Human (Homo sapiens) [TaxId:9606] [49158] (2 PDB entries)

8. Domain d1i8lb2: 1i8l B:106-199 [61973]
   Other proteins in same PDB: d1i8la1, d1i8lb1, d1i8lc_, d1i8ld_
   complexed to ctla-4
   complexed with man, nag

Details for d1i8lb2

PDB Entry: 1i8l, 3 Å

PDB Description: human b7-1/ctla-4 co-stimulatory complex

PDB Compounds: (B:) t lymphocyte activation antigen cd80

SCOPe Domain Sequences for d1i8lb2:

Sequence; same for both SEQRES and ATOM records:

>d1i8lb2 b.1.1.3 (B:106-199) CD80, second domain {Human (Homo sapiens) [TaxId: 9606]}
adfptpsisdfeiptsnirriicstsggfpephlswlengeelnainttvsqdpetelya
vsskldfnmttnhsfmclikyghlrvnqtfnwnt

Timeline for d1i8lb2:

• d1i8lb2 first appeared in SCOP 1.57
  
• d1i8lb2 appears in SCOPe 2.07