Lineage for d1i8la2 (1i8l A:106-199)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2364787Family b.1.1.3: C2 set domains [49142] (8 proteins)
  6. 2364844Protein CD80, second domain [49157] (1 species)
    a soluble form of b7-1
  7. 2364845Species Human (Homo sapiens) [TaxId:9606] [49158] (2 PDB entries)
  8. 2364847Domain d1i8la2: 1i8l A:106-199 [61971]
    Other proteins in same PDB: d1i8la1, d1i8lb1, d1i8lc_, d1i8ld_
    complexed to ctla-4
    complexed with man, nag

Details for d1i8la2

PDB Entry: 1i8l (more details), 3 Å

PDB Description: human b7-1/ctla-4 co-stimulatory complex
PDB Compounds: (A:) t lymphocyte activation antigen cd80

SCOPe Domain Sequences for d1i8la2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i8la2 b.1.1.3 (A:106-199) CD80, second domain {Human (Homo sapiens) [TaxId: 9606]}
adfptpsisdfeiptsnirriicstsggfpephlswlengeelnainttvsqdpetelya
vsskldfnmttnhsfmclikyghlrvnqtfnwnt

SCOPe Domain Coordinates for d1i8la2:

Click to download the PDB-style file with coordinates for d1i8la2.
(The format of our PDB-style files is described here.)

Timeline for d1i8la2: