![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein CD80, N-terminal domain [48745] (1 species) a soluble form of b7-1 |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48746] (2 PDB entries) |
![]() | Domain d1i8la1: 1i8l A:1-105 [61970] Other proteins in same PDB: d1i8la2, d1i8lb2, d1i8lc_, d1i8ld_ ctla-4 co-stimulatory complex complexed with man, nag |
PDB Entry: 1i8l (more details), 3 Å
SCOPe Domain Sequences for d1i8la1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i8la1 b.1.1.1 (A:1-105) CD80, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} vihvtkevkevatlscghnvsveelaqtriywqkekkmvltmmsgdmniwpeyknrtifd itnnlsivilalrpsdegtyecvvlkyekdafkrehlaevtlsvk
Timeline for d1i8la1:
![]() Domains from other chains: (mouse over for more information) d1i8lb1, d1i8lb2, d1i8lc_, d1i8ld_ |