Lineage for d1i8la1 (1i8l A:1-105)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2352628Protein CD80, N-terminal domain [48745] (1 species)
    a soluble form of b7-1
  7. 2352629Species Human (Homo sapiens) [TaxId:9606] [48746] (2 PDB entries)
  8. 2352631Domain d1i8la1: 1i8l A:1-105 [61970]
    Other proteins in same PDB: d1i8la2, d1i8lb2, d1i8lc_, d1i8ld_
    ctla-4 co-stimulatory complex
    complexed with man, nag

Details for d1i8la1

PDB Entry: 1i8l (more details), 3 Å

PDB Description: human b7-1/ctla-4 co-stimulatory complex
PDB Compounds: (A:) t lymphocyte activation antigen cd80

SCOPe Domain Sequences for d1i8la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i8la1 b.1.1.1 (A:1-105) CD80, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
vihvtkevkevatlscghnvsveelaqtriywqkekkmvltmmsgdmniwpeyknrtifd
itnnlsivilalrpsdegtyecvvlkyekdafkrehlaevtlsvk

SCOPe Domain Coordinates for d1i8la1:

Click to download the PDB-style file with coordinates for d1i8la1.
(The format of our PDB-style files is described here.)

Timeline for d1i8la1: