Class b: All beta proteins [48724] (178 folds) |
Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) |
Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins) forms homo and heteroheptameric ring structures Pfam PF01423 |
Protein Archaeal homoheptameric Sm protein [63758] (6 species) |
Species Pyrobaculum aerophilum [TaxId:13773] [63760] (2 PDB entries) smap1 |
Domain d1i8fe_: 1i8f E: [61963] Other proteins in same PDB: d1i8fc2, d1i8fd2, d1i8ff2 complexed with gol |
PDB Entry: 1i8f (more details), 1.75 Å
SCOPe Domain Sequences for d1i8fe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i8fe_ b.38.1.1 (E:) Archaeal homoheptameric Sm protein {Pyrobaculum aerophilum [TaxId: 13773]} tlgatlqdsigkqvlvklrdsheirgilrsfdqhvnllledaeeiidgnvykrgtmvvrg envlfispvp
Timeline for d1i8fe_: