Lineage for d1i8fe_ (1i8f E:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2396390Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2396391Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2396392Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins)
    forms homo and heteroheptameric ring structures
    Pfam PF01423
  6. 2396393Protein Archaeal homoheptameric Sm protein [63758] (6 species)
  7. 2396489Species Pyrobaculum aerophilum [TaxId:13773] [63760] (2 PDB entries)
    smap1
  8. 2396494Domain d1i8fe_: 1i8f E: [61963]
    Other proteins in same PDB: d1i8fc2, d1i8fd2, d1i8ff2
    complexed with gol

Details for d1i8fe_

PDB Entry: 1i8f (more details), 1.75 Å

PDB Description: the crystal structure of a heptameric archaeal sm protein: implications for the eukaryotic snrnp core
PDB Compounds: (E:) putative snrnp sm-like protein

SCOPe Domain Sequences for d1i8fe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i8fe_ b.38.1.1 (E:) Archaeal homoheptameric Sm protein {Pyrobaculum aerophilum [TaxId: 13773]}
tlgatlqdsigkqvlvklrdsheirgilrsfdqhvnllledaeeiidgnvykrgtmvvrg
envlfispvp

SCOPe Domain Coordinates for d1i8fe_:

Click to download the PDB-style file with coordinates for d1i8fe_.
(The format of our PDB-style files is described here.)

Timeline for d1i8fe_: