Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein CD86 (b7-2), N-terminal domain [63635] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [63636] (3 PDB entries) |
Domain d1i85a_: 1i85 A: [61946] Other proteins in same PDB: d1i85c_, d1i85d_ complexed to ctla-4 |
PDB Entry: 1i85 (more details), 3.2 Å
SCOPe Domain Sequences for d1i85a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i85a_ b.1.1.1 (A:) CD86 (b7-2), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} mlkiqayfnetadlpcqfansqnqslselvvfwqdqenlvlnevylgkekfdsvhskymg rtsfdsdswtlrlhnlqikdkglyqciihhkkptgmirihqmnselsvla
Timeline for d1i85a_: