Lineage for d1i85a_ (1i85 A:)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) Superfamily b.1.1: Immunoglobulin [48726] (6 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) 
Protein CD86 (b7-2), N-terminal domain [63635] (1 species) Species Human (Homo sapiens) [TaxId:9606] [63636] (1 PDB entry) 
Domain d1i85a_: 1i85 A: [61946]
Other proteins in same PDB: d1i85c_, d1i85d_
Details for d1i85a_
PDB Entry: 1i85 (more details), 3.2 Å
PDB Description: crystal structure of the ctla-4/b7-2 complex
SCOP Domain Sequences for d1i85a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i85a_ b.1.1.1 (A:) CD86 (b7-2), N-terminal domain {Human (Homo sapiens)}
mlkiqayfnetadlpcqfansqnqslselvvfwqdqenlvlnevylgkekfdsvhskymg
rtsfdsdswtlrlhnlqikdkglyqciihhkkptgmirihqmnselsvla
SCOP Domain Coordinates for d1i85a_:
Click to download the PDB-style file with coordinates for d1i85a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1i85a_:
- d1i85a_ first appeared in SCOP 1.57
- d1i85a_ appears in SCOP 1.61
- d1i85a_ appears in the current release, SCOPe 2.08, called d1i85a1
View in 3D
