Class b: All beta proteins [48724] (104 folds) |
Fold b.38: Sm motif of small nuclear ribonucleoproteins, SNRNP [50181] (1 superfamily) |
Superfamily b.38.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50182] (1 family) |
Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (5 proteins) |
Protein Archaeal homoheptameric Sm protein [63758] (3 species) |
Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [63759] (1 PDB entry) |
Domain d1i81a_: 1i81 A: [61930] |
PDB Entry: 1i81 (more details), 2 Å
SCOP Domain Sequences for d1i81a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i81a_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Methanobacterium thermoautotrophicum} rvnvqrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledgevtrrlg tvlirgdnivyisp
Timeline for d1i81a_: