SCOP 1.57: Domain d1i7zd1: 1i7z D:1-113

Lineage for d1i7zd1 (1i7z D:1-113)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)

7. Species Fab GNC92H2, (mouse/human chimera), kappa L chain [63646] (1 PDB entry)

8. Domain d1i7zd1: 1i7z D:1-113 [61925]
   Other proteins in same PDB: d1i7za2, d1i7zb2, d1i7zc2, d1i7zd2

Details for d1i7zd1

PDB Entry: 1i7z, 2.3 Å

PDB Description: antibody gnc92h2 bound to ligand

SCOP Domain Sequences for d1i7zd1:

Sequence; same for both SEQRES and ATOM records:

>d1i7zd1 b.1.1.1 (D:1-113) Immunoglobulin (variable domains of L and H chains) {Fab GNC92H2, (mouse/human chimera), kappa L chain}
qvqlqqsgpelkkpgetvkiscktsgysftnygmnwvkqapgkglkwmgwintytgepty
addfrgrfafslatsastaylqiinlknedtatyfcetydsplgdywgqgttvtvss

Timeline for d1i7zd1:

• d1i7zd1 is new in SCOP 1.57
  
• d1i7zd1 appears in SCOP 1.59
  
• d1i7zd1 appears in the current release, SCOPe 2.08