Lineage for d1i7zc1 (1i7z C:1-107)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2022563Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2023025Species Mouse (Mus musculus), cluster 2 [TaxId:10090] [88526] (28 PDB entries)
  8. 2023033Domain d1i7zc1: 1i7z C:1-107 [61923]
    Other proteins in same PDB: d1i7za2, d1i7zb1, d1i7zb2, d1i7zc2, d1i7zd1, d1i7zd2
    part of humanized Fab GNC92H2
    complexed with coc

Details for d1i7zc1

PDB Entry: 1i7z (more details), 2.3 Å

PDB Description: antibody gnc92h2 bound to ligand
PDB Compounds: (C:) chimera of ig kappa chain: human constant region and mouse variable region

SCOPe Domain Sequences for d1i7zc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i7zc1 b.1.1.1 (C:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]}
dlvltqspaslavslgqratiscrasksvstsgynymhwyqqkpgqppklliylasnlas
gvparfsgsgsgtdftlnihpveeedaatyyclysrefppwtfgggtkleik

SCOPe Domain Coordinates for d1i7zc1:

Click to download the PDB-style file with coordinates for d1i7zc1.
(The format of our PDB-style files is described here.)

Timeline for d1i7zc1: