![]() | Class b: All beta proteins [48724] (104 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species) |
![]() | Species Fab GNC92H2, (mouse/human chimera), kappa L chain [63657] (1 PDB entry) |
![]() | Domain d1i7zb2: 1i7z B:114-228 [61922] Other proteins in same PDB: d1i7za1, d1i7zb1, d1i7zc1, d1i7zd1 |
PDB Entry: 1i7z (more details), 2.3 Å
SCOP Domain Sequences for d1i7zb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i7zb2 b.1.1.2 (B:114-228) Immunoglobulin (constant domains of L and H chains) {Fab GNC92H2, (mouse/human chimera), kappa L chain} astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
Timeline for d1i7zb2: