SCOP 1.71: Domain d1i7zb1: 1i7z B:1-113

Lineage for d1i7zb1 (1i7z B:1-113)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88554] (32 PDB entries)

8. Domain d1i7zb1: 1i7z B:1-113 [61921]
   Other proteins in same PDB: d1i7za1, d1i7za2, d1i7zb2, d1i7zc1, d1i7zc2, d1i7zd2

Details for d1i7zb1

PDB Entry: 1i7z, 2.3 Å

PDB Description: antibody gnc92h2 bound to ligand

SCOP Domain Sequences for d1i7zb1:

Sequence; same for both SEQRES and ATOM records:

>d1i7zb1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4}
qvqlqqsgpelkkpgetvkiscktsgysftnygmnwvkqapgkglkwmgwintytgepty
addfrgrfafslatsastaylqiinlknedtatyfcetydsplgdywgqgttvtvss

Timeline for d1i7zb1:

• d1i7zb1 first appeared in SCOP 1.57
  
• d1i7zb1 appears in SCOP 1.69
  
• d1i7zb1 appears in SCOP 1.73
  
• d1i7zb1 appears in the current release, SCOPe 2.08