Lineage for d1i7zb1 (1i7z B:1-113)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 158189Species Fab GNC92H2, (mouse/human chimera), kappa L chain [63646] (1 PDB entry)
  8. 158191Domain d1i7zb1: 1i7z B:1-113 [61921]
    Other proteins in same PDB: d1i7za2, d1i7zb2, d1i7zc2, d1i7zd2

Details for d1i7zb1

PDB Entry: 1i7z (more details), 2.3 Å

PDB Description: antibody gnc92h2 bound to ligand

SCOP Domain Sequences for d1i7zb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i7zb1 b.1.1.1 (B:1-113) Immunoglobulin (variable domains of L and H chains) {Fab GNC92H2, (mouse/human chimera), kappa L chain}
qvqlqqsgpelkkpgetvkiscktsgysftnygmnwvkqapgkglkwmgwintytgepty
addfrgrfafslatsastaylqiinlknedtatyfcetydsplgdywgqgttvtvss

SCOP Domain Coordinates for d1i7zb1:

Click to download the PDB-style file with coordinates for d1i7zb1.
(The format of our PDB-style files is described here.)

Timeline for d1i7zb1: