Lineage for d1i7za1 (1i7z A:1-107)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 782637Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 783080Species Mouse (Mus musculus), cluster 2 [TaxId:10090] [88526] (30 PDB entries)
  8. 783087Domain d1i7za1: 1i7z A:1-107 [61919]
    Other proteins in same PDB: d1i7za2, d1i7zb1, d1i7zb2, d1i7zc2, d1i7zd1, d1i7zd2
    part of humanized Fab GNC92H2

Details for d1i7za1

PDB Entry: 1i7z (more details), 2.3 Å

PDB Description: antibody gnc92h2 bound to ligand
PDB Compounds: (A:) chimera of ig kappa chain: human constant region and mouse variable region

SCOP Domain Sequences for d1i7za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i7za1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]}
dlvltqspaslavslgqratiscrasksvstsgynymhwyqqkpgqppklliylasnlas
gvparfsgsgsgtdftlnihpveeedaatyyclysrefppwtfgggtkleik

SCOP Domain Coordinates for d1i7za1:

Click to download the PDB-style file with coordinates for d1i7za1.
(The format of our PDB-style files is described here.)

Timeline for d1i7za1: