Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species) |
Species Fab GNC92H2, (mouse/human chimera), kappa L chain [63646] (1 PDB entry) |
Domain d1i7za1: 1i7z A:1-107 [61919] Other proteins in same PDB: d1i7za2, d1i7zb2, d1i7zc2, d1i7zd2 |
PDB Entry: 1i7z (more details), 2.3 Å
SCOP Domain Sequences for d1i7za1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i7za1 b.1.1.1 (A:1-107) Immunoglobulin (variable domains of L and H chains) {Fab GNC92H2, (mouse/human chimera), kappa L chain} dlvltqspaslavslgqratiscrasksvstsgynymhwyqqkpgqppklliylasnlas gvparfsgsgsgtdftlnihpveeedaatyyclysrefppwtfgggtkleik
Timeline for d1i7za1: