SCOP 1.75: Domain d1i7ya_: 1i7y A:

Lineage for d1i7ya_ (1i7y A:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (6 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore

6. Protein Phycocyanin alpha subunit [88933] (7 species)

7. Species Synechococcus vulcanus [TaxId:32053] [88938] (3 PDB entries)

8. Domain d1i7ya_: 1i7y A: [61917]
   Other proteins in same PDB: d1i7yb_
   complexed with cyc

Details for d1i7ya_

PDB Entry: 1i7y, 2.5 Å

PDB Description: crystal structure of c-phycocyanin of synechococcus vulcanus at 2.5 angstroms.

PDB Compounds: (A:) c-phycocyanin alpha subunit

SCOP Domain Sequences for d1i7ya_:

Sequence; same for both SEQRES and ATOM records:

>d1i7ya_ a.1.1.3 (A:) Phycocyanin alpha subunit {Synechococcus vulcanus [TaxId: 32053]}
mktpiteaiaaadtqgrflsntelqavdgrfkravasmeaaraltnnaqslidgaaqavy
qkfpytttmqgsqyastpegkakcardigyylrmityclvaggtgpmdeyliaglseins
tfdlspswyiealkyikanhgltgqaaveanayidyainals

Timeline for d1i7ya_:

• d1i7ya_ first appeared in SCOP 1.57
  
• d1i7ya_ appears in SCOP 1.73
  
• d1i7ya_ appears in SCOPe 2.01
  
• d1i7ya_ appears in the current release, SCOPe 2.08