Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.177: FAH [56528] (1 superfamily) unusual fold; contains 3 layers of beta-sheet structure |
Superfamily d.177.1: FAH [56529] (2 families) |
Family d.177.1.1: FAH [56530] (7 proteins) automatically mapped to Pfam PF01557 |
Protein 4-hydroxyphenylacetate degradation bifunctional isomerase/decarboxylase HpcE [64459] (1 species) duplication: tandem repeat of two FAH domains |
Species Escherichia coli [TaxId:562] [64460] (2 PDB entries) |
Domain d1i7od1: 1i7o D:1-213 [61899] complexed with ca |
PDB Entry: 1i7o (more details), 1.7 Å
SCOPe Domain Sequences for d1i7od1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i7od1 d.177.1.1 (D:1-213) 4-hydroxyphenylacetate degradation bifunctional isomerase/decarboxylase HpcE {Escherichia coli [TaxId: 562]} mkgtifavalnhrsqldawqeafqqspykappktavwfikprntvigcgepipfpqgekv lsgatvalivgktatkvreedaaeyiagyalandvslpeesfyrpaikakcrdgfcpige tvalsnvdnltiyteingrpadhwntadlqrnaaqllsalsefatlnpgdaillgtpqar veiqpgdrvrvlaegfpplenpvvderevttrk
Timeline for d1i7od1: