Lineage for d1i7ob2 (1i7o B:214-429)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2561549Fold d.177: FAH [56528] (1 superfamily)
    unusual fold; contains 3 layers of beta-sheet structure
  4. 2561550Superfamily d.177.1: FAH [56529] (2 families) (S)
  5. 2561551Family d.177.1.1: FAH [56530] (7 proteins)
    automatically mapped to Pfam PF01557
  6. 2561559Protein 4-hydroxyphenylacetate degradation bifunctional isomerase/decarboxylase HpcE [64459] (1 species)
    duplication: tandem repeat of two FAH domains
  7. 2561560Species Escherichia coli [TaxId:562] [64460] (2 PDB entries)
  8. 2561572Domain d1i7ob2: 1i7o B:214-429 [61896]
    complexed with ca

Details for d1i7ob2

PDB Entry: 1i7o (more details), 1.7 Å

PDB Description: crystal structure of hpce
PDB Compounds: (B:) 4-hydroxyphenylacetate degradation bifunctional isomerase/decarboxylase

SCOPe Domain Sequences for d1i7ob2:

Sequence, based on SEQRES records: (download)

>d1i7ob2 d.177.1.1 (B:214-429) 4-hydroxyphenylacetate degradation bifunctional isomerase/decarboxylase HpcE {Escherichia coli [TaxId: 562]}
sfptlphphgtlfalglnyadhaselefkppeeplvflkapntltgdnqtsvrpnnieym
hyeaelvvvigkqarnvseadamdyvagytvcndyairdylenyyrpnlrvksrdgltpm
lstivpkeaipdphnltlrtfvngelrqqgttadlifsvpfliaylsefmtlnpgdmiat
gtpkglsdvvpgdevvvevegvgrlvnrivseetak

Sequence, based on observed residues (ATOM records): (download)

>d1i7ob2 d.177.1.1 (B:214-429) 4-hydroxyphenylacetate degradation bifunctional isomerase/decarboxylase HpcE {Escherichia coli [TaxId: 562]}
sfptlphphgtlfalglnyadhpeeplvflkapntltgdnqtsvrpnnieymhyeaelvv
vigkqarnvseadamdyvagytvcndyairdylenyyrpnlrvksrdgltpmlstivpke
aipdphnltlrtfvngelrqqgttadlifsvpfliaylsefmtlnpgdmiatgtpkglsd
vvpgdevvvevegvgrlvnrivseetak

SCOPe Domain Coordinates for d1i7ob2:

Click to download the PDB-style file with coordinates for d1i7ob2.
(The format of our PDB-style files is described here.)

Timeline for d1i7ob2: