Lineage for d1i6vb1 (1i6v B:3-49,B:173-232)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 506235Fold d.74: DCoH-like [55247] (4 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 506311Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families) (S)
    form homo and heterodimers
  5. 506312Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins)
  6. 506313Protein RNA polymerase alpha [55259] (3 species)
  7. 506319Species Thermus aquaticus [TaxId:271] [64314] (1 PDB entry)
  8. 506321Domain d1i6vb1: 1i6v B:3-49,B:173-232 [61854]
    Other proteins in same PDB: d1i6va2, d1i6vb2, d1i6vc_, d1i6vd_, d1i6ve_

Details for d1i6vb1

PDB Entry: 1i6v (more details), 3.3 Å

PDB Description: thermus aquaticus core rna polymerase-rifampicin complex

SCOP Domain Sequences for d1i6vb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i6vb1 d.74.3.1 (B:3-49,B:173-232) RNA polymerase alpha {Thermus aquaticus}
esklkapvftattqgdhygefvleplergfgvtlgnplrrillssipXpvrrvafqvedt
rlgqrtdldkltlriwtdgsvtplealnqavailkehlnyfanpeass

SCOP Domain Coordinates for d1i6vb1:

Click to download the PDB-style file with coordinates for d1i6vb1.
(The format of our PDB-style files is described here.)

Timeline for d1i6vb1: