Lineage for d1i6va2 (1i6v A:50-172)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 615331Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
    unusual fold; contains a left-handed beta-alpha-beta unit
  4. 615332Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) (S)
  5. 615333Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins)
  6. 615334Protein RNA polymerase alpha subunit [56555] (3 species)
  7. 615340Species Thermus aquaticus [TaxId:271] [64461] (1 PDB entry)
  8. 615341Domain d1i6va2: 1i6v A:50-172 [61853]
    Other proteins in same PDB: d1i6va1, d1i6vb1, d1i6vc_, d1i6vd_, d1i6ve_

Details for d1i6va2

PDB Entry: 1i6v (more details), 3.3 Å

PDB Description: thermus aquaticus core rna polymerase-rifampicin complex

SCOP Domain Sequences for d1i6va2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i6va2 d.181.1.1 (A:50-172) RNA polymerase alpha subunit {Thermus aquaticus}
gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrfldpkmasttlilraegpkev
ravdftpsadveimnpdlhiatleeggklymevrvdrgvgyvpaerhgikdrinaipvda
ifs

SCOP Domain Coordinates for d1i6va2:

Click to download the PDB-style file with coordinates for d1i6va2.
(The format of our PDB-style files is described here.)

Timeline for d1i6va2: