SCOP 1.73: Domain d1i6ua_: 1i6u A:

Lineage for d1i6ua_ (1i6u A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)
   consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a

4. Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family)

5. Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)

6. Protein Ribosomal protein S8 [56049] (4 species)

7. Species Archaeon Methanococcus jannaschii [TaxId:2190] [64401] (1 PDB entry)

8. Domain d1i6ua_: 1i6u A: [61850]

Details for d1i6ua_

PDB Entry: 1i6u, 2.6 Å

PDB Description: rna-protein interactions: the crystal structure of ribosomal protein s8/rrna complex from methanococcus jannaschii

PDB Compounds: (A:) 30s ribosomal protein s8p

SCOP Domain Sequences for d1i6ua_:

Sequence; same for both SEQRES and ATOM records:

>d1i6ua_ d.140.1.1 (A:) Ribosomal protein S8 {Archaeon Methanococcus jannaschii [TaxId: 2190]}
slmdplanalnhisncervgkkvvyikpaskligrvlkvmqdngyigefefiedgragif
kveligkinkcgaikprfpvkkfgyekfekrylpardfgilivsttqgvmsheeakkrgl
ggrllayvy

Timeline for d1i6ua_:

• d1i6ua_ first appeared in SCOP 1.57
  
• d1i6ua_ appears in SCOP 1.71
  
• d1i6ua_ appears in SCOP 1.75
  
• d1i6ua_ appears in the current release, SCOPe 2.08