Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.140: Ribosomal protein S8 [56046] (1 superfamily) consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a |
Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) |
Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein) |
Protein Ribosomal protein S8 [56049] (4 species) |
Species Archaeon Methanococcus jannaschii [TaxId:2190] [64401] (1 PDB entry) |
Domain d1i6ua_: 1i6u A: [61850] |
PDB Entry: 1i6u (more details), 2.6 Å
SCOP Domain Sequences for d1i6ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i6ua_ d.140.1.1 (A:) Ribosomal protein S8 {Archaeon Methanococcus jannaschii} slmdplanalnhisncervgkkvvyikpaskligrvlkvmqdngyigefefiedgragif kveligkinkcgaikprfpvkkfgyekfekrylpardfgilivsttqgvmsheeakkrgl ggrllayvy
Timeline for d1i6ua_: