Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
Fold d.74: DCoH-like [55247] (4 superfamilies) |
Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families) |
Family d.74.3.2: RPB11 [64311] (1 protein) |
Protein RPB11 [64312] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64313] (3 PDB entries) |
Domain d1i6hk_: 1i6h K: [61842] Other proteins in same PDB: d1i6ha_, d1i6hb_, d1i6hc1, d1i6hc2, d1i6he1, d1i6he2, d1i6hf_, d1i6hh_, d1i6hi1, d1i6hi2, d1i6hj_, d1i6hl_ |
PDB Entry: 1i6h (more details), 3.3 Å
SCOP Domain Sequences for d1i6hk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i6hk_ d.74.3.2 (K:) RPB11 {Baker's yeast (Saccharomyces cerevisiae)} mnapdrfelfllgegesklkidpdtkapnavvitfekedhtlgnliraellndrkvlfaa ykvehpffarfklriqttegydpkdalknacnsiinklgalktnfetewnlqtl
Timeline for d1i6hk_: