Lineage for d1i6hk_ (1i6h K:)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.74: DCoH-like [55247] (4 superfamilies) 
Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families) 
Family d.74.3.2: RPB11 [64311] (1 protein) Protein RPB11 [64312] (1 species) Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64313] (3 PDB entries) 
Domain d1i6hk_: 1i6h K: [61842]
Other proteins in same PDB: d1i6ha_, d1i6hb_, d1i6hc1, d1i6hc2, d1i6he1, d1i6he2, d1i6hf_, d1i6hh_, d1i6hi1, d1i6hi2, d1i6hj_, d1i6hl_
Details for d1i6hk_
PDB Entry: 1i6h (more details), 3.3 Å
PDB Description: rna polymerase ii elongation complex
SCOP Domain Sequences for d1i6hk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i6hk_ d.74.3.2 (K:) RPB11 {Baker's yeast (Saccharomyces cerevisiae)}
mnapdrfelfllgegesklkidpdtkapnavvitfekedhtlgnliraellndrkvlfaa
ykvehpffarfklriqttegydpkdalknacnsiinklgalktnfetewnlqtl
SCOP Domain Coordinates for d1i6hk_:
Click to download the PDB-style file with coordinates for d1i6hk_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1i6hk_:
- d1i6hk_ is new in SCOP 1.57
- d1i6hk_ appears in SCOP 1.59
- d1i6hk_ appears in the current release, SCOPe 2.08
View in 3D
