Class a: All alpha proteins [46456] (286 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family) automatically mapped to Pfam PF01194 |
Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (2 proteins) Zn-binding site is near the N-terminus |
Protein RNA polymerase subunit RPB10 [46926] (3 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63490] (28 PDB entries) Uniprot P22139; part of multichain biological unit |
Domain d1i6hj_: 1i6h J: [61841] Other proteins in same PDB: d1i6ha_, d1i6hb_, d1i6hc1, d1i6hc2, d1i6he1, d1i6he2, d1i6hf_, d1i6hh_, d1i6hi1, d1i6hi2, d1i6hk_, d1i6hl_ protein/DNA complex; protein/RNA complex; complexed with mg, zn |
PDB Entry: 1i6h (more details), 3.3 Å
SCOPe Domain Sequences for d1i6hj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i6hj_ a.4.11.1 (J:) RNA polymerase subunit RPB10 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf lrynp
Timeline for d1i6hj_: