Lineage for d1i6hj_ (1i6h J:)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies) 
Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family) 
Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (1 protein) Protein RNA polymerase subunit RPB10 [46926] (2 species) Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63490] (3 PDB entries) 
Domain d1i6hj_: 1i6h J: [61841]
Other proteins in same PDB: d1i6ha_, d1i6hb_, d1i6hc1, d1i6hc2, d1i6he1, d1i6he2, d1i6hf_, d1i6hh_, d1i6hi1, d1i6hi2, d1i6hk_, d1i6hl_
Details for d1i6hj_
PDB Entry: 1i6h (more details), 3.3 Å
PDB Description: rna polymerase ii elongation complex
SCOP Domain Sequences for d1i6hj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i6hj_ a.4.11.1 (J:) RNA polymerase subunit RPB10 {Baker's yeast (Saccharomyces cerevisiae)}
mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
lrynp
SCOP Domain Coordinates for d1i6hj_:
Click to download the PDB-style file with coordinates for d1i6hj_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1i6hj_:
- d1i6hj_ is new in SCOP 1.57
- d1i6hj_ appears in SCOP 1.59
- d1i6hj_ appears in the current release, SCOPe 2.08
View in 3D
