Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
Superfamily c.52.3: Eukaryotic RPB5 N-terminal domain [53036] (1 family) |
Family c.52.3.1: Eukaryotic RPB5 N-terminal domain [53037] (1 protein) |
Protein Eukaryotic RPB5 N-terminal domain [53038] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53039] (25 PDB entries) |
Domain d1i6he1: 1i6h E:2-143 [61835] Other proteins in same PDB: d1i6ha_, d1i6hb_, d1i6hc1, d1i6hc2, d1i6he2, d1i6hf_, d1i6hh_, d1i6hi1, d1i6hi2, d1i6hj_, d1i6hk_, d1i6hl_ complexed with mg, zn |
PDB Entry: 1i6h (more details), 3.3 Å
SCOP Domain Sequences for d1i6he1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i6he1 c.52.3.1 (E:2-143) Eukaryotic RPB5 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} dqenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsfq anpteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsam klvpsippatietfneaalvvn
Timeline for d1i6he1: