Lineage for d1i6hc2 (1i6h C:42-172)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 879236Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
    unusual fold; contains a left-handed beta-alpha-beta unit
  4. 879237Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) (S)
  5. 879238Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins)
  6. 879291Protein RPB3 [64462] (1 species)
  7. 879292Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64463] (24 PDB entries)
    Uniprot P16370; part of multichain biological unit
  8. 879300Domain d1i6hc2: 1i6h C:42-172 [61834]
    Other proteins in same PDB: d1i6ha_, d1i6hb_, d1i6hc1, d1i6he1, d1i6he2, d1i6hf_, d1i6hh_, d1i6hi1, d1i6hi2, d1i6hj_, d1i6hk_, d1i6hl_
    complexed with mg, zn

Details for d1i6hc2

PDB Entry: 1i6h (more details), 3.3 Å

PDB Description: rna polymerase ii elongation complex
PDB Compounds: (C:) DNA-directed RNA polymerase II 45kd polypeptide

SCOP Domain Sequences for d1i6hc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i6hc2 d.181.1.1 (C:42-172) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ptlaidsvevetnttvladefiahrlgliplqsmdieqleysrdcfcedhcdkcsvvltl
qafgesesttnvyskdlvivsnlmgrnighpiiqdkegngvlicklrkgqelkltcvakk
giakehakwgp

SCOP Domain Coordinates for d1i6hc2:

Click to download the PDB-style file with coordinates for d1i6hc2.
(The format of our PDB-style files is described here.)

Timeline for d1i6hc2: