Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily) unusual fold; contains a left-handed beta-alpha-beta unit |
Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) |
Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins) |
Protein RPB3 [64462] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64463] (24 PDB entries) |
Domain d1i6hc2: 1i6h C:42-172 [61834] Other proteins in same PDB: d1i6ha_, d1i6hb_, d1i6hc1, d1i6he1, d1i6he2, d1i6hf_, d1i6hh_, d1i6hi1, d1i6hi2, d1i6hj_, d1i6hk_, d1i6hl_ complexed with mg, zn |
PDB Entry: 1i6h (more details), 3.3 Å
SCOP Domain Sequences for d1i6hc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i6hc2 d.181.1.1 (C:42-172) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ptlaidsvevetnttvladefiahrlgliplqsmdieqleysrdcfcedhcdkcsvvltl qafgesesttnvyskdlvivsnlmgrnighpiiqdkegngvlicklrkgqelkltcvakk giakehakwgp
Timeline for d1i6hc2: