SCOP 1.73: Domain d1i6hc2: 1i6h C:42-172

Lineage for d1i6hc2 (1i6h C:42-172)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
   unusual fold; contains a left-handed beta-alpha-beta unit

4. Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family)

5. Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins)

6. Protein RPB3 [64462] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64463] (24 PDB entries)

8. Domain d1i6hc2: 1i6h C:42-172 [61834]
   Other proteins in same PDB: d1i6ha_, d1i6hb_, d1i6hc1, d1i6he1, d1i6he2, d1i6hf_, d1i6hh_, d1i6hi1, d1i6hi2, d1i6hj_, d1i6hk_, d1i6hl_
   complexed with mg, zn

Details for d1i6hc2

PDB Entry: 1i6h, 3.3 Å

PDB Description: rna polymerase ii elongation complex

PDB Compounds: (C:) DNA-directed RNA polymerase II 45kd polypeptide

SCOP Domain Sequences for d1i6hc2:

Sequence; same for both SEQRES and ATOM records:

>d1i6hc2 d.181.1.1 (C:42-172) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ptlaidsvevetnttvladefiahrlgliplqsmdieqleysrdcfcedhcdkcsvvltl
qafgesesttnvyskdlvivsnlmgrnighpiiqdkegngvlicklrkgqelkltcvakk
giakehakwgp

Timeline for d1i6hc2:

• d1i6hc2 first appeared in SCOP 1.57
  
• d1i6hc2 appears in SCOP 1.71
  
• d1i6hc2 appears in SCOP 1.75
  
• d1i6hc2 appears in the current release, SCOPe 2.08