Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
Protein Hydrogen peroxide-inducible genes LysR-type activator OxyR, regulatory domain [64193] (1 species) |
Species Escherichia coli [TaxId:562] [64194] (2 PDB entries) |
Domain d1i69a_: 1i69 A: [61825] complexed with bez |
PDB Entry: 1i69 (more details), 2.7 Å
SCOPe Domain Sequences for d1i69a_:
Sequence, based on SEQRES records: (download)
>d1i69a_ c.94.1.1 (A:) Hydrogen peroxide-inducible genes LysR-type activator OxyR, regulatory domain {Escherichia coli [TaxId: 562]} etmsgplhigliptvgpyllphiipmlhqtfpklemylheaqthqllaqldsgkldavil alvkeseafievplfdepmllaiyedhpwanreavpmadlagekllmledghslrdqamg fcfeagadedthfratsletlrnmvaagsgitllpalavpperkrdgvvylpaikpeprr tiglvyrpgsplrsryeqlaeairarmdghfd
>d1i69a_ c.94.1.1 (A:) Hydrogen peroxide-inducible genes LysR-type activator OxyR, regulatory domain {Escherichia coli [TaxId: 562]} etmsgplhigliptvgpyllphiipmlhqtfpklemylheaqthqllaqldsgkldavil alvkeseafievplfdepmllaiyedhpwanreavpmadlagekllmledghslrdqamg fcfdthfratsletlrnmvaagsgitllpalavpperkrdgvvylpaikpeprrtiglvy rpgsplrsryeqlaeairarmdghfd
Timeline for d1i69a_: