Lineage for d1i5qb_ (1i5q B:)

  1. Root: SCOPe 2.01
  2. 1054197Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1054403Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1054404Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1054405Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1054419Protein AMPC beta-Lactamase, class C [56618] (3 species)
    contains small alpha+beta subdomain inserted in the common fold
  7. 1054437Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (66 PDB entries)
  8. 1054479Domain d1i5qb_: 1i5q B: [61821]
    complexed with mox; mutant

Details for d1i5qb_

PDB Entry: 1i5q (more details), 1.83 Å

PDB Description: crystal structure of the e. coli ampc beta-lactamase mutant n152a covalently acylated with the inhibitory beta-lactam, moxalactam
PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d1i5qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i5qb_ e.3.1.1 (B:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyaassiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq

SCOPe Domain Coordinates for d1i5qb_:

Click to download the PDB-style file with coordinates for d1i5qb_.
(The format of our PDB-style files is described here.)

Timeline for d1i5qb_: