Lineage for d1i55b_ (1i55 B:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 633823Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 633824Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 633825Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)
  6. 633998Protein Mitochondrial cytochrome c [46642] (6 species)
  7. 634042Species Bluefin tuna (Thunnus thynnus) [TaxId:8237] [46646] (5 PDB entries)
    identical sequence to Thunnus alalunga, TaxId: 8235
  8. 634049Domain d1i55b_: 1i55 B: [61771]
    complexed with hem, znh

Details for d1i55b_

PDB Entry: 1i55 (more details), 2 Å

PDB Description: cytochrome c (tuna) with 2zn:1fe mixed-metal porphyrins
PDB Compounds: (B:) cytochrome c

SCOP Domain Sequences for d1i55b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i55b_ a.3.1.1 (B:) Mitochondrial cytochrome c {Bluefin tuna (Thunnus thynnus) [TaxId: 8237]}
gdvakgkktfvqkcaqchtvenggkhkvgpnlwglfgrktgqaegysytdankskgivwn
ndtlmeylenpkkyipgtkmifagikkkgerqdlvaylksats

SCOP Domain Coordinates for d1i55b_:

Click to download the PDB-style file with coordinates for d1i55b_.
(The format of our PDB-style files is described here.)

Timeline for d1i55b_: