Lineage for d1i54a_ (1i54 A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 277141Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 277142Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 277143Family a.3.1.1: monodomain cytochrome c [46627] (13 proteins)
  6. 277289Protein Mitochondrial cytochrome c [46642] (5 species)
  7. 277346Species Tuna (Thunnus alalunga and Thunnus thynnus) [46646] (5 PDB entries)
  8. 277350Domain d1i54a_: 1i54 A: [61768]

Details for d1i54a_

PDB Entry: 1i54 (more details), 1.5 Å

PDB Description: cytochrome c (tuna) 2fe:1zn mixed-metal porphyrins

SCOP Domain Sequences for d1i54a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i54a_ a.3.1.1 (A:) Mitochondrial cytochrome c {Tuna (Thunnus alalunga and Thunnus thynnus)}
gdvakgkktfvqkcaqchtvenggkhkvgpnlwglfgrktgqaegysytdankskgivwn
ndtlmeylenpkkyipgtkmifagikkkgerqdlvaylksats

SCOP Domain Coordinates for d1i54a_:

Click to download the PDB-style file with coordinates for d1i54a_.
(The format of our PDB-style files is described here.)

Timeline for d1i54a_: