SCOP 1.61: Domain d1i54a_: 1i54 A:

Lineage for d1i54a_ (1i54 A:)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)

4. Superfamily a.3.1: Cytochrome c [46626] (7 families)

5. Family a.3.1.1: monodomain cytochrome c [46627] (13 proteins)

6. Protein Mitochondrial cytochrome c [46642] (5 species)

7. Species Tuna (Thunnus alalunga and Thunnus thynnus) [46646] (5 PDB entries)

8. Domain d1i54a_: 1i54 A: [61768]

Details for d1i54a_

PDB Entry: 1i54, 1.5 Å

PDB Description: cytochrome c (tuna) 2fe:1zn mixed-metal porphyrins

SCOP Domain Sequences for d1i54a_:

Sequence; same for both SEQRES and ATOM records:

>d1i54a_ a.3.1.1 (A:) Mitochondrial cytochrome c {Tuna (Thunnus alalunga and Thunnus thynnus)}
gdvakgkktfvqkcaqchtvenggkhkvgpnlwglfgrktgqaegysytdankskgivwn
ndtlmeylenpkkyipgtkmifagikkkgerqdlvaylksats

Timeline for d1i54a_:

• d1i54a_ first appeared in SCOP 1.57
  
• d1i54a_ appears in SCOP 1.59
  
• d1i54a_ appears in SCOP 1.63
  
• d1i54a_ appears in the current release, SCOPe 2.08