SCOP 1.71: Domain d1i50j_: 1i50 J:

Lineage for d1i50j_ (1i50 J:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family)

5. Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (1 protein)
   Zn-binding site is near the N-terminus

6. Protein RNA polymerase subunit RPB10 [46926] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63490] (9 PDB entries)

8. Domain d1i50j_: 1i50 J: [61764]
   Other proteins in same PDB: d1i50a_, d1i50b_, d1i50c1, d1i50c2, d1i50e1, d1i50e2, d1i50f_, d1i50h_, d1i50i1, d1i50i2, d1i50k_, d1i50l_
   complexed with mn, zn

Details for d1i50j_

PDB Entry: 1i50, 2.8 Å

PDB Description: rna polymerase ii crystal form ii at 2.8 a resolution

SCOP Domain Sequences for d1i50j_:

Sequence; same for both SEQRES and ATOM records:

>d1i50j_ a.4.11.1 (J:) RNA polymerase subunit RPB10 {Baker's yeast (Saccharomyces cerevisiae)}
mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
lrynp

Timeline for d1i50j_:

• d1i50j_ first appeared in SCOP 1.57
  
• d1i50j_ appears in SCOP 1.69
  
• d1i50j_ appears in SCOP 1.73
  
• d1i50j_ appears in the current release, SCOPe 2.08