Class a: All alpha proteins [46456] (226 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family) |
Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (1 protein) Zn-binding site is near the N-terminus |
Protein RNA polymerase subunit RPB10 [46926] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63490] (9 PDB entries) |
Domain d1i50j_: 1i50 J: [61764] Other proteins in same PDB: d1i50a_, d1i50b_, d1i50c1, d1i50c2, d1i50e1, d1i50e2, d1i50f_, d1i50h_, d1i50i1, d1i50i2, d1i50k_, d1i50l_ complexed with mn, zn |
PDB Entry: 1i50 (more details), 2.8 Å
SCOP Domain Sequences for d1i50j_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i50j_ a.4.11.1 (J:) RNA polymerase subunit RPB10 {Baker's yeast (Saccharomyces cerevisiae)} mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf lrynp
Timeline for d1i50j_: