Class g: Small proteins [56992] (75 folds) |
Fold g.41: Rubredoxin-like [57769] (13 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.3: Zinc beta-ribbon [57783] (3 families) |
Family g.41.3.1: Transcriptional factor domain [57784] (3 proteins) |
Protein RBP9 subunit of RNA polymerase II [57787] (2 species) contains two differently decorated domains of this fold |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (4 PDB entries) |
Domain d1i50i1: 1i50 I:1-49 [61762] Other proteins in same PDB: d1i50a_, d1i50b_, d1i50c1, d1i50c2, d1i50e1, d1i50e2, d1i50f_, d1i50h_, d1i50j_, d1i50k_, d1i50l_ |
PDB Entry: 1i50 (more details), 2.8 Å
SCOP Domain Sequences for d1i50i1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i50i1 g.41.3.1 (I:1-49) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae)} mttfrfcrdcnnmlypredkennrllfecrtcsyveeagsplvyrheli
Timeline for d1i50i1: