Lineage for d1i4xa2 (1i4x A:121-239)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 253998Fold d.15: beta-Grasp (ubiquitin-like) [54235] (10 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 254362Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 254363Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (12 proteins)
  6. 254394Protein Staphylococcal enterotoxin C2, SEC2 [54338] (1 species)
  7. 254395Species Staphylococcus aureus [TaxId:1280] [54339] (7 PDB entries)
  8. 254401Domain d1i4xa2: 1i4x A:121-239 [61737]
    Other proteins in same PDB: d1i4xa1
    complexed with zn

Details for d1i4xa2

PDB Entry: 1i4x (more details), 2.4 Å

PDB Description: staphylococcal enterotoxin c2, monoclinic form crystallized at ph 8.0

SCOP Domain Sequences for d1i4xa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i4xa2 d.15.6.1 (A:121-239) Staphylococcal enterotoxin C2, SEC2 {Staphylococcus aureus}
nhfdngnlqnvlirvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnssp
yetgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng

SCOP Domain Coordinates for d1i4xa2:

Click to download the PDB-style file with coordinates for d1i4xa2.
(The format of our PDB-style files is described here.)

Timeline for d1i4xa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i4xa1