SCOPe 2.01: Domain d1i4xa1: 1i4x A:1-120

Lineage for d1i4xa1 (1i4x A:1-120)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (15 proteins)

6. Protein Staphylococcal enterotoxin C2, SEC2 [50222] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [50223] (8 PDB entries)

8. Domain d1i4xa1: 1i4x A:1-120 [61736]
   Other proteins in same PDB: d1i4xa2
   complexed with zn

Details for d1i4xa1

PDB Entry: 1i4x, 2.4 Å

PDB Description: staphylococcal enterotoxin c2, monoclinic form crystallized at ph 8.0

PDB Compounds: (A:) enterotoxin type c-2

SCOPe Domain Sequences for d1i4xa1:

Sequence, based on SEQRES records:

>d1i4xa1 b.40.2.2 (A:1-120) Staphylococcal enterotoxin C2, SEC2 {Staphylococcus aureus [TaxId: 1280]}
esqpdptpdelhksseftgtmgnmkylyddhyvsatkvmsvdkflahdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnvgkvtggktcmyggitkheg

Sequence, based on observed residues (ATOM records):

>d1i4xa1 b.40.2.2 (A:1-120) Staphylococcal enterotoxin C2, SEC2 {Staphylococcus aureus [TaxId: 1280]}
esqpdptpdelhksseftgtmgnmkylyddhyvsatkvmsvdkflahdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsskdntggktcmyggitkheg

Timeline for d1i4xa1:

• d1i4xa1 first appeared in SCOP 1.57
  
• d1i4xa1 appears in SCOP 1.75
  
• d1i4xa1 appears in SCOPe 2.02
  
• d1i4xa1 appears in the current release, SCOPe 2.08