SCOPe 2.03: Domain d1i4td_: 1i4t D:

Lineage for d1i4td_ (1i4t D:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rac [52595] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52596] (17 PDB entries)

8. Domain d1i4td_: 1i4t D: [61731]
   Other proteins in same PDB: d1i4ta_, d1i4tb_
   rac1 in complex with arfaptin
   complexed with gnp, mg

Details for d1i4td_

PDB Entry: 1i4t, 2.6 Å

PDB Description: crystal structure analysis of rac1-gmppnp in complex with arfaptin

PDB Compounds: (D:) ras-related c3 botulinum toxin substrate 1

SCOPe Domain Sequences for d1i4td_:

Sequence; same for both SEQRES and ATOM records:

>d1i4td_ c.37.1.8 (D:) Rac {Human (Homo sapiens) [TaxId: 9606]}
qaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtagl
edydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcpntpiilvgtkldlrd
dkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavlc

Timeline for d1i4td_:

• d1i4td_ first appeared in SCOP 1.57
  
• d1i4td_ appears in SCOPe 2.02
  
• d1i4td_ appears in SCOPe 2.04
  
• d1i4td_ appears in the current release, SCOPe 2.08