SCOP 1.71: Domain d1i4tb_: 1i4t B:

Lineage for d1i4tb_ (1i4t B:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.238: BAR/IMD domain-like [116747] (1 superfamily)
   6 helices, homodimer of 3-helical domains

4. Superfamily a.238.1: BAR/IMD domain-like [103657] (2 families)
   core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends

5. Family a.238.1.2: Arfaptin, Rac-binding fragment [64599] (1 protein)

6. Protein Arfaptin, Rac-binding fragment [64600] (1 species)
   active form is a dimer

7. Species Human (Homo sapiens) [TaxId:9606] [64601] (4 PDB entries)

8. Domain d1i4tb_: 1i4t B: [61730]
   Other proteins in same PDB: d1i4td_
   complexed with gnp, mg; mutant

Details for d1i4tb_

PDB Entry: 1i4t, 2.6 Å

PDB Description: crystal structure analysis of rac1-gmppnp in complex with arfaptin

SCOP Domain Sequences for d1i4tb_:

Sequence, based on SEQRES records:

>d1i4tb_ a.238.1.2 (B:) Arfaptin, Rac-binding fragment {Human (Homo sapiens)}
vdlelelqiellretkrkyesvlqlgraltahlysllqtqhalgdafadlsqkspelqee
fgynaetqkllckngetllgavnffvssintlvtktmedtlmtvkqyeaarleydayrtd
leelslgprdagtrgrlesaqatfqahrdkyeklrgdvaiklkfleenkikvmhkqlllf
hnavsayfagnqkqleqt

Sequence, based on observed residues (ATOM records):

>d1i4tb_ a.238.1.2 (B:) Arfaptin, Rac-binding fragment {Human (Homo sapiens)}
vdlelelqiellretkrkyesvlqlgraltahlysllqtqhalgdafadlsqkspelqee
fgynaetqkllckngetllgavnffvssintlvtktmedtlmtvkqyeaarleydayrtd
leelslgprdkyeklrgdvaiklkfleenkikvmhkqlllfhnavsayfagnqkqleqt

Timeline for d1i4tb_:

• d1i4tb_ first appeared in SCOP 1.57
  
• d1i4tb_ appears in SCOP 1.69
  
• d1i4tb_ appears in SCOP 1.73
  
• d1i4tb_ appears in the current release, SCOPe 2.08