Lineage for d1i4ra1 (1i4r A:1-120)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58940Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 59002Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 59304Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (11 proteins)
  6. 59330Protein Staphylococcal enterotoxin C2, SEC2 [50222] (1 species)
  7. 59331Species Staphylococcus aureus [TaxId:1280] [50223] (7 PDB entries)
  8. 59333Domain d1i4ra1: 1i4r A:1-120 [61727]
    Other proteins in same PDB: d1i4ra2

Details for d1i4ra1

PDB Entry: 1i4r (more details), 2.1 Å

PDB Description: crystal structure of staphylococcal enterotoxin c2 at 100k crystallized at ph 6.5
PDB Compounds: (A:)

SCOP Domain Sequences for d1i4ra1:

Sequence, based on SEQRES records: (download)

>d1i4ra1 b.40.2.2 (A:1-120) Staphylococcal enterotoxin C2, SEC2 {Staphylococcus aureus}
esqpdptpdelhksseftgtmgnmkylyddhyvsatkvmsvdkflahdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnvgkvtggktcmyggitkheg

Sequence, based on observed residues (ATOM records): (download)

>d1i4ra1 b.40.2.2 (A:1-120) Staphylococcal enterotoxin C2, SEC2 {Staphylococcus aureus}
esqpdptpdelhksseftgtmgnmkylyddhyvsatkvmsvdkflahdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnggktcmyggitkheg

SCOP Domain Coordinates for d1i4ra1:

Click to download the PDB-style file with coordinates for d1i4ra1.
(The format of our PDB-style files is described here.)

Timeline for d1i4ra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i4ra2