Lineage for d1i4qa1 (1i4q A:1-120)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2788203Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2788945Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)
  6. 2789001Protein Staphylococcal enterotoxin C2, SEC2 [50222] (1 species)
  7. 2789002Species Staphylococcus aureus [TaxId:1280] [50223] (8 PDB entries)
  8. 2789008Domain d1i4qa1: 1i4q A:1-120 [61725]
    Other proteins in same PDB: d1i4qa2
    complexed with zn

Details for d1i4qa1

PDB Entry: 1i4q (more details), 2.2 Å

PDB Description: crystal structure of staphylococcal enterotoxin c2 at 100k crystallized at ph 6.0
PDB Compounds: (A:) enterotoxin type c-2

SCOPe Domain Sequences for d1i4qa1:

Sequence, based on SEQRES records: (download)

>d1i4qa1 b.40.2.2 (A:1-120) Staphylococcal enterotoxin C2, SEC2 {Staphylococcus aureus [TaxId: 1280]}
esqpdptpdelhksseftgtmgnmkylyddhyvsatkvmsvdkflahdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnvgkvtggktcmyggitkheg

Sequence, based on observed residues (ATOM records): (download)

>d1i4qa1 b.40.2.2 (A:1-120) Staphylococcal enterotoxin C2, SEC2 {Staphylococcus aureus [TaxId: 1280]}
esqpdptpdelhksseftgtmgnmkylyddhyvsatkvmsvdkflahdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnggktcmyggitkheg

SCOPe Domain Coordinates for d1i4qa1:

Click to download the PDB-style file with coordinates for d1i4qa1.
(The format of our PDB-style files is described here.)

Timeline for d1i4qa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i4qa2