![]() | Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (10 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) ![]() |
![]() | Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (12 proteins) |
![]() | Protein Staphylococcal enterotoxin C2, SEC2 [54338] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [54339] (7 PDB entries) |
![]() | Domain d1i4pa2: 1i4p A:121-239 [61724] Other proteins in same PDB: d1i4pa1 complexed with zn |
PDB Entry: 1i4p (more details), 2 Å
SCOP Domain Sequences for d1i4pa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i4pa2 d.15.6.1 (A:121-239) Staphylococcal enterotoxin C2, SEC2 {Staphylococcus aureus} nhfdngnlqnvlirvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnssp yetgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng
Timeline for d1i4pa2: