Lineage for d1i41g_ (1i41 G:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 589118Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 589119Superfamily c.67.1: PLP-dependent transferases [53383] (6 families) (S)
  5. 589415Family c.67.1.3: Cystathionine synthase-like [53402] (14 proteins)
  6. 589463Protein Cystathionine gamma-synthase, CGS [53405] (2 species)
  7. 589464Species Common tobacco (Nicotiana tabacum) [TaxId:4097] [53407] (4 PDB entries)
  8. 589491Domain d1i41g_: 1i41 G: [61645]

Details for d1i41g_

PDB Entry: 1i41 (more details), 3.2 Å

PDB Description: cystathionine gamma-synthase in complex with the inhibitor appa

SCOP Domain Sequences for d1i41g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i41g_ c.67.1.3 (G:) Cystathionine gamma-synthase, CGS {Common tobacco (Nicotiana tabacum)}
yasflnsdgsvaihagerlgrgivtdaittpvvntsayffnktselidfkekrrasfeyg
rygnpttvvleekisalegaestllmasgmcastvmllalvpagghivtttdcyrktrif
ietilpkmgitatvidpadvgalelalnqkkvnlfftesptnpflrcvdielvsklchek
galvcidgtfatplnqkalalgadlvlhsatkflgghndvlagcisgplklvseirnlhh
ilggalnpnaayliirgmktlhlrvqqqnstalrmaeileahpkvrhvyypglqshpehh
iakkqmtgfggavsfevdgdllttakfvdalkipyiapsfggcesivdqpaimsywdlsq
sdrakygimdnlvrfsfgvedfddlkadilqaldsi

SCOP Domain Coordinates for d1i41g_:

Click to download the PDB-style file with coordinates for d1i41g_.
(The format of our PDB-style files is described here.)

Timeline for d1i41g_: